Protein Info for OH686_23235 in Pseudomonas sp. S08-1

Annotation: Putative inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 309 to 338 (30 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 258 (231 residues), 42.9 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfv:Psefu_1416)

Predicted SEED Role

"putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>OH686_23235 Putative inner membrane protein (Pseudomonas sp. S08-1)
MLSANLVRRLGAAINAEHREIKPAFTGFFLFFCLFCGYFMLRPIRESMGIMAGIENLQWL
FTATFVVMLIAVPLFAWLSSRVPRLHFIDWVYGFFCLNLLVFSGLFQLSSDSVWLARVFY
VWISVYNLFVVSVAWSLMADVFDGQQAKRLFAFIAAGASVGGLVGPALASLLVGVTGPAG
LVLLAAVLLGVALALKTPLMRWREIDGAGRPGAVKPESSHRPVAGNPLSGLTRVIQSPYL
LAVAGFVVLLAAVTTLLYFEQARLVAERFPDRESQIRVFGVIDVIVQAGALLSQLFITGR
IAKKMGVRMLLAIMPILVCLGFICLALAPTFAVLAALMVVRRIGEYAFIRPGREMLFAPL
DAESKYKAKNFIDTVVYRAGDALSGWLKSGLDTLGQGAMLVALTGAVCALVWGGLGWYLG
KQADEFSRRTEPERKLDMQLSS