Protein Info for OH686_23080 in Pseudomonas sp. S08-1

Annotation: Organosulfonate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00005: ABC_tran" amino acids 33 to 171 (139 residues), 111.3 bits, see alignment E=3e-36

Best Hits

Swiss-Prot: 48% identical to Y3647_BRUA2: Putative ATP-binding protein BAB2_1147 (BAB2_1147) from Brucella abortus (strain 2308)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 87% identity to ppu:PP_0209)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>OH686_23080 Organosulfonate ABC transporter ATP-binding protein (Pseudomonas sp. S08-1)
MSVYQKAPEPGRIDGRQLSIRLGQGREAFEAVQALDFTVEPGEFVCILGPSGCGKSTLLG
ALAGHLRPAGGSLLVDNAPVAGPSPERGMVFQHHTLLPWRSVLDNVAFGLKMQGIGQAER
HRQAAEMLRLVGLQDFATRWPNQLSGGMQQRAEIARVLINRPRLLLMDEPFGALDAQTRA
RMQELLLDIWTRIRTTLVFVTHDIDEALFLADRILVMSPRPGRFIEDLRLDFPRPRNASL
LTSPGFVHLKRHCLELLRHEEGRELPRLTPLGLPTTEHPPLRIAL