Protein Info for OH686_22525 in Pseudomonas sp. S08-1

Annotation: Monooxygenase, flavin-binding family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF07992: Pyr_redox_2" amino acids 15 to 208 (194 residues), 43.2 bits, see alignment E=1e-14 PF00743: FMO-like" amino acids 15 to 382 (368 residues), 171.9 bits, see alignment E=6e-54 PF13738: Pyr_redox_3" amino acids 16 to 212 (197 residues), 75.8 bits, see alignment E=1.1e-24 PF13450: NAD_binding_8" amino acids 16 to 51 (36 residues), 25.8 bits, see alignment 3.1e-09 PF13434: Lys_Orn_oxgnase" amino acids 93 to 210 (118 residues), 31.2 bits, see alignment E=4e-11

Best Hits

KEGG orthology group: None (inferred from 76% identity to pmk:MDS_2580)

Predicted SEED Role

"Monooxygenase, flavin-binding family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>OH686_22525 Monooxygenase, flavin-binding family (Pseudomonas sp. S08-1)
MLAEHNQKDKPCMHAIIGAGPMGLAAARQLQRHGIPFVGFELHSDVGGLWDIANPHSTLY
QSAHLISSKGATAFAEFPMPDAVPPYPHHSQIGQYFRDYAEHFGLRQHYQFNTRVVRLER
LSQGWRLVSEQDGTLREWQFEGVLIANGTLHRPNQPALPGRFTGELLHSSVYKNAELFAD
KRVLVIGCGNSACDIAVDAVHRAKSVDLSVRRGYHFLPKFILGKPTDTFGGAIKLPRRLK
QLVDGLLVRALLGKPSQYGLPDPDYRLYESHPVMNSLVLHHIGHGDIQPRGDIRAVDGKR
VTFANGDSAEYDLILQATGYRLDYPFIDRAELNWPLEADAPQLYLNVFHPLHDDLFMLGM
IEASGLGWQGRAEQAELVALVIAQQQRNSASARRFRDLVLDRAGQRLDGGFAYLKLPRMA
YYVHKNSYRAALKAHIAELSRDLTTTQTEERLDVQRQS