Protein Info for OH686_21795 in Pseudomonas sp. S08-1

Annotation: molybdenum cofactor biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 TIGR02667: molybdenum cofactor biosynthesis protein B" amino acids 9 to 170 (162 residues), 284.9 bits, see alignment E=1.6e-89 TIGR00177: molybdenum cofactor synthesis domain" amino acids 13 to 151 (139 residues), 111 bits, see alignment E=4.9e-36 PF00994: MoCF_biosynth" amino acids 15 to 156 (142 residues), 101.4 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 58% identical to MOAB_ECO57: Molybdenum cofactor biosynthesis protein B (moaB) from Escherichia coli O157:H7

KEGG orthology group: K03638, molybdenum cofactor biosynthesis protein B (inferred from 91% identity to pfv:Psefu_2928)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>OH686_21795 molybdenum cofactor biosynthesis protein B (Pseudomonas sp. S08-1)
MSHKAEAAFVPLNIAVLTVSDTRSLETDTSGQLFVDRLAAAGHHLAARVLLKDDLYRIRA
QVAQWIAEDEVQVVLITGGTGFTGRDSTPEAVRCLLDKQVDGFGELFRQISVADIGTSTI
QSRALAGLANGTLVCCLPGSTNACRTAWDGILGEQLDNRHRPCNFVPHLKQAAACESRG