Protein Info for OH686_21360 in Pseudomonas sp. S08-1

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 317 to 337 (21 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 419 to 444 (26 residues), see Phobius details amino acids 455 to 479 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 46 to 479 (434 residues), 287.3 bits, see alignment E=1e-89 PF03448: MgtE_N" amino acids 64 to 165 (102 residues), 84.8 bits, see alignment E=8.2e-28 PF00571: CBS" amino acids 167 to 223 (57 residues), 20.1 bits, see alignment 9.8e-08 amino acids 231 to 286 (56 residues), 41.7 bits, see alignment 1.8e-14 PF01769: MgtE" amino acids 351 to 474 (124 residues), 111.9 bits, see alignment E=3.7e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 92% identity to pmk:MDS_1759)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>OH686_21360 magnesium transporter (Pseudomonas sp. S08-1)
MTEVEAKKPQESLQDRLAQVVELLHRHKLVESLTHRQEGQHQDLVENLVHRQNLAELQRK
LDELHSADVAHILEALPLGDRLTVWQLVKAERDGDILLEVSDAVRESLIADMDDHEILAA
AKDMDADELADLAPELPRDVVLELMESLDAQQRERVRSALSYEDDQVGALMDFEMVTIRE
DVSLEVVLRYLRRLKELPGHTDKLFVVDYDGVLKGVLPIKRLLVNDPDKQVGEVMASDPV
SFQPDEDAHDAAQAFERYDLISAPVVDKEGRLIGRLTIDEMVDLIREESESEVLNMAGLR
EEEDIFASVWKSLGNRWAWLAINLITAFLASRVIGLFEGSIEKLVALAALMPIVAGIGGN
SGNQTITMIVRAMALDQVGTGNTSRLMRKELGVALINGLVWGGVIGVVAFWLYDSWSLGL
VMTGAMTLNLLLAALMGVLIPMTLVRMGRDPAMGASVMITAMTDSGGFFIFLGLATLFLL