Protein Info for OH686_21260 in Pseudomonas sp. S08-1

Annotation: Arginine/ornithine ABC transporter, permease protein AotQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 8 to 115 (108 residues), 68.1 bits, see alignment E=3.9e-23 PF00528: BPD_transp_1" amino acids 27 to 221 (195 residues), 80.6 bits, see alignment E=6.2e-27

Best Hits

Swiss-Prot: 51% identical to HISQ_ECOLI: Histidine transport system permease protein HisQ (hisQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to pmk:MDS_1742)

Predicted SEED Role

"Arginine/ornithine ABC transporter, permease protein AotQ" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>OH686_21260 Arginine/ornithine ABC transporter, permease protein AotQ (Pseudomonas sp. S08-1)
MFNGYGSTILDGAWLTVQLAALSMAVAIVLGLFGAACRLSPMKWLALMGDAYATVIRGIP
DLVLILLIFYGGQDLVNRIAPLVGYEDYIDINPFIAGVGTLGFIYGAYLSETFRGAFMAI
PKGQGEAGMAYGMSPLRVFLRILVPQMIRLAIPGATNSWLVLVKATALISLVGLQDMMAR
AKSAGDATREPFTYILLAAAIYLVLTSVSLVVLRYLERRYSVGVKTAEI