Protein Info for OH686_20950 in Pseudomonas sp. S08-1

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 315 (293 residues), 107 bits, see alignment E=5.2e-35

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 71% identity to pmy:Pmen_1245)

Predicted SEED Role

"Cyanate MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>OH686_20950 Uncharacterized MFS-type transporter (Pseudomonas sp. S08-1)
MKPVSRALLMLALVLAAINLRPGITSFAPLIERIAAELSLSRGLISLTTALPVLCMGLLA
PLAPRLAVRFGLERTITCCLGLIMLALLLRFGGHTSVLLIGSAVLLGAGIAVAGPLLSGF
IKRHFRDHVGQVVGWYSFSMAIGGAGGAVLTVPLTQNLGDDWSLGLAAWFVPALLAGLLW
LRLPNRTEEAVASDGQGLPWREPRAWLVTGFFAIQAGFFYTMATWLVARYHEAGLSLLYS
NGLFSLFMLVGLPSSWLMPWLAQRFDIRQPLLVACGLSLTLCLTMITFQPILLPEVWAVL
MGFALSGSFALSLVLPLYEVHTPLAVSRWTAMMLCAGYCMACLAPILAGLGRDLAGHYQA
PFMVLIGLGVLMTLIAWALRTPKRPA