Protein Info for OH686_20865 in Pseudomonas sp. S08-1

Annotation: phosphoserine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01364: phosphoserine transaminase
  • amino acids 6 to 360 (355 residues), 548 bits, E=4.3e-169
• PF00266: Aminotran_5
  • amino acids 7 to 349 (343 residues), 157.7 bits, E=2.1e-50

Best Hits

Swiss-Prot: 91% identical to SERC_PSEA8: Phosphoserine aminotransferase (serC) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 93% identity to pfv:Psefu_2017)

MetaCyc: 52% identical to phosphoserine aminotransferase (Arabidopsis thaliana col)
Phosphoserine transaminase. [EC: 2.6.1.52]

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Protein Sequence (361 amino acids)

>OH686_20865 phosphoserine transaminase (Pseudomonas sp. S08-1)
MSKRAHNFCAGPAALPTAVLQRAQAEMLDWQGKGLSVMEMSHRSDEYVAIAEKAEQDLRD
LLSIPNDYKVLFLQGGASQQFAEIPLNLLPEDGTADYIETGIWSKKAIDEARRYGNVNVA
ASAKGYDYFAIPGQNEWQLSKDAAYVHYASNETIGGLQFDWIPEVGDTPLVVDMSSDILS
REIDVSKFGLIYAGAQKNIGPSGLVVAIIREDLLGRARSVCPTMLNYKIAADNGSMYNTP
ATYSWYLSGLVFEWLKEQGGVAAMEQRNKAKKDLLYKAIDASDFYSNPIQPSARSWMNVP
FRLADEKLDKAFLAGADARGLLNLKGHRSVGGMRASIYNATGLDAVEALVAYMAEFEKEH
A