Protein Info for OH686_20765 in Pseudomonas sp. S08-1

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 146 to 169 (24 residues), see Phobius details PF00672: HAMP" amino acids 166 to 221 (56 residues), 29.7 bits, see alignment 1.3e-10 PF00512: HisKA" amino acids 226 to 288 (63 residues), 46.9 bits, see alignment E=4.5e-16 PF02518: HATPase_c" amino acids 334 to 439 (106 residues), 83.2 bits, see alignment E=3.7e-27

Best Hits

KEGG orthology group: None (inferred from 73% identity to pmy:Pmen_1829)

Predicted SEED Role

"Putative two-component system sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>OH686_20765 Two-component system sensor histidine kinase (Pseudomonas sp. S08-1)
MRSLFWRIFASFWLAVALVAGLSMLLGRALDQDAWVLGRHPALKDVAELWSQLYERNGPE
AAQQFLEKRKQRYRVNIQVLNEEGQALVYGTFPPRAAAFEARHDNPKRLPWRRITEEYRS
PATGETYLFIYRIPHPEMMAWHRESLFWPLSALTIALVVLTAISLLLTLSITRPLGRLRG
AVYDLGQTAYQQNSLARLADRGDEFGVLARDFNRMGSRLQDLIGSQRQLLRDVSHELRSP
LARLRVALALTERAEPAQRDQLWGRLTQECDRLEALIAEILALARLDADPGTPQPVDLRR
LLDGLLEDAALATPEQRLQVRMDSRPIALQGWPDMLGRALDNLLRNALRFNPVEQPIEIE
VSQQDGFLRIAVRDHGPGAPAEIIERLGEPFFRAPKQEAPGHGLGLAIARRAAERHEGQL
LLANHPQGGFVATLELPLAE