Protein Info for OH686_19190 in Pseudomonas sp. S08-1

Annotation: quinolinate synthetase complex, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 30 to 341 (312 residues), 371.9 bits, E=1.2e-115
• PF02445: NadA
  • amino acids 33 to 339 (307 residues), 360.3 bits, E=3.6e-112

Best Hits

Swiss-Prot: 92% identical to NADA_PSEMY: Quinolinate synthase A (nadA) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 92% identity to pmk:MDS_1316)

MetaCyc: 68% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Protein Sequence (352 amino acids)

>OH686_19190 quinolinate synthetase complex, A subunit (Pseudomonas sp. S08-1)
MTQISERLLVQAHLDAKQPKPLTPDEEAFYRSEIAAELKKQNAVLVAHYYCDPVIQALAE
ETGGCVSDSLEMARFGNQHEAQTVVVAGVKFMGETAKILNPEKRVLMPTLEATCSLDLGC
PVDEFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSCALEIVESLMDNGEKILWAPDQ
HLGRYIQRETGADMLLWDGACIVHEEFKAKQLEDMKALYPEAAILVHPESPEAVIELADA
VGSTSQLIKAAQTLPNKTFIVATDRGIFYKMQQLCPDKVFVEAPTAGNGAACRSCAHCPW
MAMNTLQRTLQCLREGSGEILVEPALIPRAIKPLKRMLDFTQAARLKLAGNA