Protein Info for OH686_19180 in Pseudomonas sp. S08-1

Annotation: queuosine biosynthesis protein QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00733: Asn_synthase
  • amino acids 1 to 62 (62 residues), 36.9 bits, E=3.5e-13
• PF06508: QueC
  • amino acids 5 to 215 (211 residues), 270.5 bits, E=8.7e-85
• TIGR00364: queuosine biosynthesis protein QueC
  • amino acids 6 to 208 (203 residues), 208.6 bits, E=3.6e-66

Best Hits

Swiss-Prot: 85% identical to QUEC_PSEMY: 7-cyano-7-deazaguanine synthase (queC) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 85% identity to pmy:Pmen_1281)

MetaCyc: 40% identical to 7-cyano-7-deazaguanine synthase (Escherichia coli K-12 substr. MG1655)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Protein Sequence (224 amino acids)

>OH686_19180 queuosine biosynthesis protein QueC (Pseudomonas sp. S08-1)
MTDKKAVVLLSGGLDSATILAQAKAAGFACYSVSFDYGQRHRAELQAAERVARQLGVVEH
KVIGLNLNGIGGSALTDSSIAVPEGPTEGIPVTYVPARNTVFLSLALGWAEVLGAHDIFI
GVNAVDYSGYPDCRPEFIAAFERVANLATREGVEGSGFRIQAPLQNLSKAQIVQIGLQYG
VDYGLTVSCYQADDDGRACGKCDSCRLRAAGFTAAGVADPTRYA