Protein Info for OH686_18630 in Pseudomonas sp. S08-1

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 TIGR00229: PAS domain S-box protein" amino acids 27 to 138 (112 residues), 60.4 bits, see alignment E=9.5e-21 PF00989: PAS" amino acids 27 to 132 (106 residues), 58.2 bits, see alignment E=3.2e-19 PF08448: PAS_4" amino acids 32 to 136 (105 residues), 57.8 bits, see alignment E=5e-19 PF13426: PAS_9" amino acids 33 to 134 (102 residues), 40.1 bits, see alignment E=1.5e-13 PF08447: PAS_3" amino acids 46 to 125 (80 residues), 30.4 bits, see alignment E=1.5e-10 PF00512: HisKA" amino acids 476 to 544 (69 residues), 38.1 bits, see alignment E=5.1e-13 PF02518: HATPase_c" amino acids 587 to 697 (111 residues), 88.5 bits, see alignment E=1.6e-28 PF14501: HATPase_c_5" amino acids 592 to 679 (88 residues), 23.4 bits, see alignment E=1.9e-08

Best Hits

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (699 amino acids)

>OH686_18630 Two-component system sensor histidine kinase (Pseudomonas sp. S08-1)
MQGHDCGASAEFDEAHATKDAMLGVDLLELVDESIFLRDLNGRIRYWNKASEELYGWSSA
EALGQPAHDLLGCQHAEALASLNQKVLDDGRWSGELSRRRADGRELLIETRWSLRRDASG
APQAIVESGRDITARKATDLILAESEYRYRNLFQAMAASFWELDFTAVGAMVRSLYKSGV
SDLRTHFRQHPELVREMMLATRVIDVNEQTVHLFGRGTKAELLTTVEPFWPQASSAVFAE
SIIAAVTKAPSYVKETRLRTIDGKEFDVLFTASFPPENMQKGILMVGVIDLSARNQAYAA
LEQSESRYRNLFEVMAVSFWQLDSNGTNRLFAELREQGVSDLPAYIDQHPEFVRRAMDAT
LAIDVNQRTLELYGARERGEMLGSVSRFWIPGHDEAFRHSLEAAWRREPGYLAETKTRTL
DGRELDVLFFVTAPPEMRERGMVLVGNIDISELVASRNALQRMQSDLAHAARISMLGELT
ASIAHEVNQPLAAIATYGEAGLRWLGRPQPDLDEVRDLTQRMVGDARRAAEIIARIRGMA
RQQSPEPQPLSLNALVKEAAAFLRHELQSQGATLRLDLETGLPRLRGDRTLLQQVLVNLL
VNALQAMTQADCATRSIVLSTRRLDEQLQLRVQDSGPGIAAEHVERLFDSFFTTKRNGMG
MGLPICRSIIENCGGSIEAEPRPAGQGACFVIRLPLPST