Protein Info for OH686_18230 in Pseudomonas sp. S08-1

Annotation: Uncharacterized conserved protein YfiP, contains DTW domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF03942: DTW" amino acids 28 to 215 (188 residues), 197.9 bits, see alignment E=7.6e-63

Best Hits

Swiss-Prot: 49% identical to YFIP_ECOLI: DTW domain-containing protein YfiP (yfiP) from Escherichia coli (strain K12)

KEGG orthology group: K05812, conserved hypothetical protein (inferred from 75% identity to pag:PLES_14291)

MetaCyc: 49% identical to tRNA 3-amino-3-carboxypropyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA-uridine aminocarboxypropyltransferase. [EC: 2.5.1.25]

Predicted SEED Role

"FIG074102: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>OH686_18230 Uncharacterized conserved protein YfiP, contains DTW domain (Pseudomonas sp. S08-1)
MSHAVARLRAERLARSLKPFVSRGSRSERCPGCRVIPSYCLCAWRPKVEVQAGVCLLMYD
VEALKPSNTGWLIADLVADTHAFGWQRTAVDPRLLALLDDPQYAPCVVFPGEYAEPERVI
EELPPLATGKRPLFILLDATWTEARKMFRKSPYLNRFPVLSLRPEQLSRYRLRRSKRDEH
LCTAEVAALCLELAGEPQAAVALDAWLDLFTEHYLGAKHRRVLDEQSPAHQALKPFL