Protein Info for OH686_18060 in Pseudomonas sp. S08-1

Annotation: Holo-[acyl-carrier-protein] synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR00556: phosphopantetheine--protein transferase domain" amino acids 1 to 121 (121 residues), 79.7 bits, see alignment E=2.1e-26 TIGR00516: holo-[acyl-carrier-protein] synthase" amino acids 2 to 121 (120 residues), 77.9 bits, see alignment E=8.1e-26 PF01648: ACPS" amino acids 3 to 99 (97 residues), 77.1 bits, see alignment E=5.5e-26

Best Hits

Swiss-Prot: 55% identical to ACPS2_ECO57: Probable holo-[acyl-carrier-protein] synthase 2 (acpS2) from Escherichia coli O157:H7

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 46% identity to pao:Pat9b_1699)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.7

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>OH686_18060 Holo-[acyl-carrier-protein] synthase  (Pseudomonas sp. S08-1)
MHIGIDIVEIERIRTASQRSGEDFMTRVYTAQERDYIGDAEANAERAAGIWAAKEAAVKA
LGSGFRDGIQFHDLCIEHEPAGRPYLVFAGRFREEMQRSGLTAASLSISHCGTHAVAAVV
LG