Protein Info for OH686_17105 in Pseudomonas sp. S08-1

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01496: dihydropteroate synthase
  • amino acids 23 to 278 (256 residues), 320.1 bits, E=6.3e-100
• PF00809: Pterin_bind
  • amino acids 25 to 264 (240 residues), 275.7 bits, E=2e-86

Best Hits

Swiss-Prot: 58% identical to DHPS_SHIFL: Dihydropteroate synthase (folP) from Shigella flexneri

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 79% identity to pmy:Pmen_3614)

MetaCyc: 58% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• superpathway of chorismate metabolism (44/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Protein Sequence (283 amino acids)

>OH686_17105 dihydropteroate synthase (Pseudomonas sp. S08-1)
MIVPQYPPRLPCGSRVLDLAQPQVMGILNVTPDSFSDGGRFAARDAAVRHAAQMVAAGAT
LIDVGGESTRPGARPVSPVEELERVAPVVEAIAAELDVIISLDTSTPAVMREGARLGAGL
INDVRALRRDGALEAAADSGLPVCLMHMLGEPGNMQQNPQYRDVVGEVRDFLAQRMTACV
EAGIPVERIVLDPGFGFAKTLAHNLSLFKRLEALHELGRPLLVGVSRKTMIGQALGREVH
ERLSGGLALVALAVAKGACILRAHDVAETVDAVRMIAAVQTAE