Protein Info for OH686_16865 in Pseudomonas sp. S08-1
Annotation: ABC transporter, ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to SSUB_BACCR: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 80% identity to avn:Avin_08090)Predicted SEED Role
"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (282 amino acids)
>OH686_16865 ABC transporter, ATP-binding protein (Pseudomonas sp. S08-1) MNSLTLPDSRTFQGLPPSPPLVSFIGVGKRFGELQAVSDFNLDIREGESIAILGSSGCGK STLLRLLVGLDREFDGRIEIAGRPVEGIGSERGIVFQEHRLFPWLTVEQNINLGLVNEDL TQAERFRRVEEFVQLVGLDGFQRAYPHQLSGGMAQRVAIARGLVASPRILLLDEPFGALD ALTRQQMQEELLAIRKRAGITSLLVTHDVEEAIFLADRVVVLAPRPGRIKRIVEIDLPHP RDRAGYDFHQLRAELLYELTGDGDYRAPPPRVEDLPLASLAY