Protein Info for OH686_16735 in Pseudomonas sp. S08-1

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR01224: imidazolonepropionase" amino acids 26 to 401 (376 residues), 455.3 bits, see alignment E=7.1e-141 PF01979: Amidohydro_1" amino acids 61 to 382 (322 residues), 60 bits, see alignment E=2.5e-20 PF07969: Amidohydro_3" amino acids 106 to 379 (274 residues), 55.1 bits, see alignment E=9.8e-19

Best Hits

Swiss-Prot: 86% identical to HUTI_PSEMY: Imidazolonepropionase (hutI) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 88% identity to pfv:Psefu_3522)

MetaCyc: 64% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>OH686_16735 imidazolonepropionase (Pseudomonas sp. S08-1)
MPLSPRPRRLWRDVILFDGLQQLPEPMAVLVEGERIAGLWSEREFDQALAAGAEEAGRGG
VMTPGLVDCHTHLVYAGNRADEFERRLEGVSYADIAKAGGGILSTVRATRAASEDELLAA
SLPRLDALLADGVTTVEIKSGYGLTLADELKMLRVARRLGELRPVRVTTTLLGAHALPPE
YAGDADGYVRLVCDEMIPAAAAEGLADAVDVFCEGIGFSAAQCERIFHAAQAYGLAIKAH
AEQLSNLGGSALAARYGALSADHIEYLDEAGVRAMAEAGTVAVLLPGAFHCLRETQLPPI
ELLRQYGVPMAVASDANPGTSPICMPSLLANLACTLFRLTPREALAGMTAHGARALGHPE
LGRIAVGAPADLCLWDIQHPAELAYAVQPGRLRQRIFAGAITHAR