Protein Info for OH686_16625 in Pseudomonas sp. S08-1

Annotation: diguanylate cyclase (GGDEF domain) with PAS/PAC sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 TIGR00229: PAS domain S-box protein" amino acids 14 to 82 (69 residues), 25.5 bits, see alignment E=6e-10 PF00989: PAS" amino acids 18 to 98 (81 residues), 34.2 bits, see alignment E=2.2e-12 PF08448: PAS_4" amino acids 23 to 139 (117 residues), 43.8 bits, see alignment E=2.7e-15

Best Hits

KEGG orthology group: None (inferred from 81% identity to pmy:Pmen_3726)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>OH686_16625 diguanylate cyclase (GGDEF domain) with PAS/PAC sensor (Pseudomonas sp. S08-1)
MTGRAQIDMQELHWLLDIVQCLDVGVLVLDRQYRIEVWNSFMENHSGLGADQVQGRELFE
LFPEIDRAWLERKVNSVLRLGTRAFSLWQQRPYLLRFKSYRPITGQADFMYQNLTVLPLA
ASRGQVEHVCLVIYDMTDAAVGQLRGG