Protein Info for OH686_16155 in Pseudomonas sp. S08-1

Annotation: large conductance mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01741: MscL
  • amino acids 3 to 131 (129 residues), 154.7 bits, E=7.2e-50
• TIGR00220: large conductance mechanosensitive channel protein
  • amino acids 4 to 133 (130 residues), 165.3 bits, E=3.6e-53

Best Hits

Swiss-Prot: 88% identical to MSCL_PSEE4: Large-conductance mechanosensitive channel (mscL) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 89% identity to pfv:Psefu_3974)

MetaCyc: 68% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Protein Sequence (136 amino acids)

>OH686_16155 large conductance mechanosensitive channel protein (Pseudomonas sp. S08-1)
MSILSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVVMPPIGLLIGGVDFSDLAIT
LKAAEGDIPAVVLSYGKFIQTVLDFVIVAFAIFMGVKVINKLKREEAAAPTVPPAPTPEE
VLLTEIRDLLKNQQKQ