Protein Info for OH686_15855 in Pseudomonas sp. S08-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 843 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 289 to 307 (19 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 339 to 364 (26 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 418 to 442 (25 residues), see Phobius details amino acids 474 to 490 (17 residues), see Phobius details amino acids 675 to 697 (23 residues), see Phobius details amino acids 703 to 724 (22 residues), see Phobius details amino acids 730 to 754 (25 residues), see Phobius details amino acids 776 to 795 (20 residues), see Phobius details amino acids 801 to 824 (24 residues), see Phobius details PF03176: MMPL" amino acids 187 to 441 (255 residues), 80.2 bits, see alignment E=2.8e-26 amino acids 641 to 823 (183 residues), 50.2 bits, see alignment E=3.8e-17 PF02460: Patched" amino acids 313 to 443 (131 residues), 31.5 bits, see alignment E=1.2e-11 amino acids 680 to 825 (146 residues), 30.2 bits, see alignment E=2.9e-11 PF12349: Sterol-sensing" amino acids 315 to 439 (125 residues), 40.3 bits, see alignment E=5.9e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (843 amino acids)

>OH686_15855 hypothetical protein (Pseudomonas sp. S08-1)
MKTRAVELLSWMLHRPWLMLAILLLISAAAVVAVGRLEINSTPYMIDKSHPSRVADADNK
RLFSNTGEQAFVALENPQGNIFNTKSLALVAELTRAFQAIEMVQPGDSDKLRALRGDARL
EADVDAILEGGLTPADQPRLLALKQRLAEAGELSHTQEAWLDSLHTRLVPIRKVRSLVTV
ENLLTVDEALDVHALMPRVPQDKAALDALRAEAMGNPLFLDSLVSRDGSATTIQVEFNIA
QDDSPAMLQVYQAIVDITDQVQGDDRIYLSGPPMIAAQTASNMEKDNQTLLPAVLLVILA
ILFISFGRLQGVVAPLLIAIFSLIWTLGLMAACGVKQNIITSIMPVFIISIAVCDAIHFL
ADYYRNLPANPDRQARIDTAFKVMQQLFWPMFVTCMTTLVGFFSLIWTDVTFIREFGIFT
GFGIFFAWLITIVFLPAIVILWKAEPPRHGLLVSDRLDRMIAALGHFARYGKKLALGMLV
AIVLCSWYVVENLTVDNQVIGYFEEDSRIRQDDAAINAKFGGTTPISIMIESSKVDAFKD
PAVIEAVAKLQEHLRQQQLVGFTYSPADFVKRLHQVTQDEFAAEHYRLPSDISGSLLAQY
YLLYENANGRDLFDVVDRRFQNGRVLAILHTDRSSEVGALMRDALDYAREVLPAGMTVRV
SGYGEVLVATTDAVVWGQINSILSSPALIVLMVMAMFHSIRLGFVALLPLLFTLVGISGL
MALSGTDLDIGTSIIAAISFGIGIDYAIHVIAAMRHSHGTPQEATQYALRHTGKPILINT
LALGLGFLVLCLSGYQSLVNLGFFISLTMLFAALFALLVLPVFVRTRQEPQASAQLQSEP
ANA