Protein Info for OH686_15370 in Pseudomonas sp. S08-1

Annotation: ribosomal protein L2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01171: ribosomal protein uL2
  • amino acids 3 to 273 (271 residues), 431.2 bits, E=8.3e-134
• PF00181: Ribosomal_L2
  • amino acids 42 to 117 (76 residues), 116 bits, E=5.9e-38
• PF03947: Ribosomal_L2_C
  • amino acids 125 to 250 (126 residues), 194.2 bits, E=7.4e-62

Best Hits

Swiss-Prot: 95% identical to RL2_PSEU5: 50S ribosomal protein L2 (rplB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02886, large subunit ribosomal protein L2 (inferred from 95% identity to psa:PST_0787)

MetaCyc: 78% identical to 50S ribosomal subunit protein L2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L2p (L8e)" in subsystem Ribosome LSU bacterial

Protein Sequence (273 amino acids)

>OH686_15370 ribosomal protein L2 (Pseudomonas sp. S08-1)
MAIVKCKPTSAGRRFVVKVVNQELHKGAPYAPLLEKKSKTGGRNNNGRITTRHIGGGHKQ
HYRLVDFRRNKDGIPAVVERVEYDPNRTAHIALLKYADGERRYIIAPKGVSAGDQLVSGA
AAPIKAGNSLPLRNIPVGSTIHAIELKPGKGAQLVRSAGASAQLVAREGAYVTLRLRSGE
MRKVLSECRATLGEVSNSEHSLRSLGKAGATRWRGVRPTVRGVAMNPVDHPHGGGEGRTS
GGRHPVSPWGFPTKGAKTRANKRTDNMIVRRRK