Protein Info for OH686_14940 in Pseudomonas sp. S08-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00753: Lactamase_B" amino acids 60 to 278 (219 residues), 78.6 bits, see alignment E=1.3e-25 PF12706: Lactamase_B_2" amino acids 76 to 147 (72 residues), 27.9 bits, see alignment E=3.5e-10 PF14863: Alkyl_sulf_dimr" amino acids 317 to 455 (139 residues), 167.8 bits, see alignment E=3.5e-53 PF14864: Alkyl_sulf_C" amino acids 475 to 587 (113 residues), 68.3 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 73% identity to pmy:Pmen_1369)

Predicted SEED Role

"Alkyl sulfatase and related hydrolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (595 amino acids)

>OH686_14940 hypothetical protein (Pseudomonas sp. S08-1)
MRTLSHFSGLLLAAALPFTANAELPAGKIEPSINAELAEHTKHFSEKVYPIADNVWSAVG
WNLANSVMIEAPEGLIIVDTGESAEQSRKVLAEFRKISSKPIKAIVYTHFHPDHINGVKG
FVSEEQVKSGEVQIYAQETLLENVVTQGALVGPILGMRSGYSFGAALSDADKKDMNAGLG
PLAHEGQSTFIAPTITFKDKLDTTIAGLPVQFLHAPSEAPDEIVLFLPNNRVLISAEVTQ
GPTLPNVHTLRGTKFRDPVVWVKSLDALRAFQAEYMVPLHGQPVSGKDKVEEVLRMTRDA
IAYIHDQTVRWMNKGLTPDELVEKVQLPPHLAGYTPYLREYYGTVKHSVRQIYNGYLGWF
QGDPVDLDPIPPVEKAKRLIELMGGRDKVLLAAGDAYLNGDYQWAAELASYSIRVDHGDT
LARDIKARSFRKLGYASMNINWRNWYLMSAMELEGKFDNGGAEEMGQRIRGAFLSADMLK
NLPARIFLQNWVTRIDPEKSADVNLTLGFVFPDIGEEWALEVRRGVVELHKGIPAGTTLK
LTLDKTYLDTVISGENGLLKGALLGDVKVDGNLLDIKTFLGCFDFEDAPIALTVR