Protein Info for OH686_14425 in Pseudomonas sp. S08-1

Annotation: glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF13579: Glyco_trans_4_4" amino acids 17 to 195 (179 residues), 50.2 bits, see alignment E=9.5e-17 PF13439: Glyco_transf_4" amino acids 21 to 194 (174 residues), 44.2 bits, see alignment E=5.3e-15 PF00534: Glycos_transf_1" amino acids 212 to 374 (163 residues), 61.8 bits, see alignment E=1.6e-20 PF13692: Glyco_trans_1_4" amino acids 238 to 366 (129 residues), 68.3 bits, see alignment E=2.3e-22 PF13524: Glyco_trans_1_2" amino acids 315 to 381 (67 residues), 27.5 bits, see alignment E=7.5e-10

Best Hits

KEGG orthology group: None (inferred from 66% identity to ppg:PputGB1_1385)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>OH686_14425 glycosyl transferase, group 1 family protein (Pseudomonas sp. S08-1)
MARVAMIVWNEFRNDARVLKEAESLTAAGHRVIVHALHAPGVTQEREVVSTGVEVVRVAR
SPFWRLRRTAAPGAPAVTVADGRIGRMGPAMQLLRIVARAWTHLALLCHMVRLRADVVHS
HDVNTLPTAWLAARLSGARLVYDAHEISTSREGYTSFRKLVAIVEKLLMPRADGTITTTE
ARAKFFARAYGISRPLVLQNRPREQLPQFSSRIREELGLSEPWPIVLYQGGVQQGRGLER
LARIAEQVPGAYFVFVGGGRLAGSLRNIAQELQVEDRVRFIPTVALADLPSYTASADIGV
QPIENTCLNHYTTDSNKLFEYVQAGLPVIASDLPEIRRIVRQHDLGLLVREGDSEALADA
LRRMVGDAQLRAHHASCARAAAPALSWEVQEHLLVELYRRILGQSKPSAS