Protein Info for OH686_14185 in Pseudomonas sp. S08-1

Annotation: Glycosyl transferase, group 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 22 to 48 (27 residues), see Phobius details amino acids 324 to 352 (29 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 66 to 298 (233 residues), 69.4 bits, see alignment E=1.1e-22 PF00535: Glycos_transf_2" amino acids 69 to 244 (176 residues), 58.9 bits, see alignment E=1.5e-19 PF13506: Glyco_transf_21" amino acids 142 to 298 (157 residues), 37.1 bits, see alignment E=5.8e-13 PF13632: Glyco_trans_2_3" amino acids 157 to 372 (216 residues), 62.1 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: None (inferred from 57% identity to tai:Taci_0167)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>OH686_14185 Glycosyl transferase, group 2 family protein (Pseudomonas sp. S08-1)
MEAVVQQWLQLFTELGKSDGLVRLLVTLLPAFLLLEVPLNMLVLLGVLRWFVRKPFELPP
DNGYRPRVSCIITCYSEGLDVQSTLRSLCEQTYAGDIEMIPVVDGAAVNKPTMQAVRDFQ
VDRTLYPRRLLRPIAKWQRGGRVSSLNSGLAHCTGDIVMALDGDTSFDNDMVVNIVRHFA
DPDVPAVAGSLRVRNWQASLTAAMQGLEYLLSIHMAKIGLSEWNLVNNVSGAFGAFRRSF
LDKIGGWDTHTAEDLDITLRIKNYFGRQPLRIPFEPRAIGHTDAPTTFKQFLMQRLRWDG
DLYFLYIRKHRHSFNPRLLGWPNFLMTLVSGFFFQLVLPFIIFGYLVIGVFVLPLANYLA
LAGLIYLVYLGVTLLMYLAMLAMVSERPRQDLRLLPIVFLFPLFMLVMRCWSAVAMLNEA
LRRGHEETSMAPWWVLKKAKRF