Protein Info for OH686_13960 in Pseudomonas sp. S08-1

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 72 (26 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details PF01810: LysE" amino acids 23 to 211 (189 residues), 122.4 bits, see alignment E=8.5e-40

Best Hits

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 85% identity to pmy:Pmen_0291)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>OH686_13960 Homoserine/homoserine lactone efflux protein (Pseudomonas sp. S08-1)
MLSEVLAMALDTWLAFFVACWVISLSPGAGAIASMSSGLQYGFWRGYWNALGLQIGLALQ
IAIVAAGVGAILSASALAFSLIKWFGVAYLVWLAIAQWRALPSDLATGAAERPIGRPLTL
VLRGFLVNASNPKAVVFMLAVLPQFIHPQEPLLPQYLIMGVTMILVDLIVMAGYTGLASR
VLRALRTPRQQRLMNRTFAGLFVGAAALLATVRRAPV