Protein Info for OH686_13915 in Pseudomonas sp. S08-1

Annotation: Uncharacterized protein EC-HemY in Proteobacteria (unrelated to HemY-type PPO in GramPositives)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 68 (26 residues), see Phobius details TIGR00540: heme biosynthesis-associated TPR protein" amino acids 5 to 392 (388 residues), 340.1 bits, see alignment E=7.1e-106 PF07219: HemY_N" amino acids 27 to 133 (107 residues), 101.4 bits, see alignment E=8.9e-33 PF13432: TPR_16" amino acids 99 to 152 (54 residues), 17.3 bits, see alignment 1.8e-06 amino acids 312 to 363 (52 residues), 19.2 bits, see alignment 4.3e-07 PF13181: TPR_8" amino acids 122 to 151 (30 residues), 14.3 bits, see alignment (E = 1.2e-05)

Best Hits

KEGG orthology group: K02498, HemY protein (inferred from 64% identity to pmk:MDS_0343)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>OH686_13915 Uncharacterized protein EC-HemY in Proteobacteria (unrelated to HemY-type PPO in GramPositives) (Pseudomonas sp. S08-1)
MIRAALLLILVVAAATALGLAIVEHSGYVLIAWKGLRYESSLWVFLLLIVVGVLLLWTLR
WLVRLLLVSGGLVNPWSRRQRGRRQQLAADKGLLDLIEGRWERAVRHLRLAAEGERQPLM
YYLGAARAAHKLGRVEESEELLEHALQRQPQAELAIALTHAELQREQGNLQGALDTLQAM
RERHPRHHLVLEQLQRTLVERGDWAALLDLLPELRKTKVLEGEALAELERKVWIARLQAA
GEQGLNQGEVALQPLTVAWQQLSSAQRQDAELLLAYAGQLRALGAQEEAEEVLRKALKQG
YDARLMRLYGQLRGRDPARQLQTAEGLLKQHPQDPLLLLSLGRLCLQNGLWGKAREYFEI
SLEFSRSAETCAELARLLASQGDVEGSNRLLQEMLLLQGQRLPHLPQPAH