Protein Info for OH686_13630 in Pseudomonas sp. S08-1
Annotation: ribosomal protein L28
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to RL28_AZOVD: 50S ribosomal protein L28 (rpmB) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
KEGG orthology group: K02902, large subunit ribosomal protein L28 (inferred from 92% identity to pfl:PFL_6049)MetaCyc: 84% identical to 50S ribosomal subunit protein L28 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L28p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (78 amino acids)
>OH686_13630 ribosomal protein L28 (Pseudomonas sp. S08-1) MSRVCQVTGKGPVTGNNVSHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID KRGIDVVLSELRARGEKV