Protein Info for OH686_13620 in Pseudomonas sp. S08-1

Annotation: UPF0758 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20582: UPF0758_N
  • amino acids 3 to 80 (78 residues), 100.3 bits, E=5.1e-33
• TIGR00608: DNA repair protein RadC
  • amino acids 11 to 223 (213 residues), 242.8 bits, E=1.7e-76
• PF04002: RadC
  • amino acids 104 to 222 (119 residues), 149.6 bits, E=3.9e-48

Best Hits

Swiss-Prot: 88% identical to Y473_PSEU5: UPF0758 protein PST_0473 (PST_0473) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 89% identity to pfv:Psefu_4303)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Protein Sequence (224 amino acids)

>OH686_13620 UPF0758 family protein (Pseudomonas sp. S08-1)
MSIRDWPAAERPREKLLELGAATLSDAELLAIFLRTGVAGQSAVDLARHLLADFGSLRAL
LEADLESFSQRLGLGPAKFAQLQAVLEMGRRHLAERLRRDSALESPQAVRDYLKARLRHE
PHEVFGCLFLDAKHRVICFEALFFGSIDGASVYPRQVVKRALAHNAAAAILVHNHPSGVA
EPSQADRLLTERLKEALGLIEVRVLDHFIVGEGEPLSMAEFGWV