Protein Info for OH686_12925 in Pseudomonas sp. S08-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 78 to 103 (26 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details PF12146: Hydrolase_4" amino acids 21 to 240 (220 residues), 73.3 bits, see alignment E=4e-24 PF00561: Abhydrolase_1" amino acids 21 to 244 (224 residues), 102.7 bits, see alignment E=5.4e-33 PF00975: Thioesterase" amino acids 22 to 102 (81 residues), 29 bits, see alignment E=2.5e-10 PF12697: Abhydrolase_6" amino acids 22 to 251 (230 residues), 94.4 bits, see alignment E=3.4e-30

Best Hits

KEGG orthology group: None (inferred from 49% identity to pmy:Pmen_1295)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>OH686_12925 hypothetical protein (Pseudomonas sp. S08-1)
MNYLNLPNGRFAYIRQGQGAPVLLLHGLGSSLLDWQPQIEHLAQHCEVIAMDVRGHGRSE
PLRAPVSMAELAGDVAAFIRALQIAPCILVGISMGGMLTFQLLAEHPELVRAAVVINSAP
SFPVDSWKVRGQIWLRLGLARLLGLPTLAKVLAGKLFPKPEQQALRELVAERLASNDRTS
YLHAMRAIPGWSALPAAGRAQVPLLVVSGDRDYTPLDYKRGYLDQLHDARLEVIEDSGHA
TPLDQPQRLNRLLQAFIAEHSAPLPA