Protein Info for OH686_12285 in Pseudomonas sp. S08-1

Annotation: protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 15 to 292 (278 residues), 344.4 bits, see alignment E=3.2e-107 PF01040: UbiA" amino acids 30 to 279 (250 residues), 231.3 bits, see alignment E=5.9e-73

Best Hits

Swiss-Prot: 91% identical to CYOE_PSEMY: Protoheme IX farnesyltransferase (cyoE) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 91% identity to pmy:Pmen_0150)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>OH686_12285 protoheme IX farnesyltransferase (Pseudomonas sp. S08-1)
MATALRAHSESASWRDYLELTKPRVVLLMLITSLVGMFLATRAGVPWTVLVFGNLGIGLC
AGAAAAVNHVVDRRIDSIMARTHKRPVTAGRLSPVAALGFALLLAVAGMALLLSFTNELA
AWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGHISAEPLLLVLII
FAWTPPHFWALAIHRKEEYAKADIPMLPVTHGEHYTKVHILLYTAVMLAVTLMPYAIHMS
GPLYLAAALVLGGRFMFWAWVLYRDSRPHAAINTFKYSIWYLFLLFIALLADHYLLLNL