Protein Info for OH686_12265 in Pseudomonas sp. S08-1

Annotation: Methionine ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 91 to 91 (1 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 40 to 215 (176 residues), 68.3 bits, see alignment E=3.9e-23

Best Hits

Swiss-Prot: 52% identical to METI_VIBCH: Probable D-methionine transport system permease protein MetI (metI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 88% identity to pmy:Pmen_4504)

MetaCyc: 51% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>OH686_12265 Methionine ABC transporter permease protein (Pseudomonas sp. S08-1)
MLEQLLANWLPNVDWEEIGYASLDTLHMLGGATLFTVLLGLPLGVLLFLTGPRQMFEQRA
LYGVLSLVVNVLRSVPFVILLILMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETA
LREVDRGIIEATQAMGASTLQIIFRALLPEALPGLIAATTVTAITLVSYTAMSGLIGGGG
LGDLAVRYGYQRYQPDVMAVTVILLLILVQVLQMVGDKLVIHFSRK