Protein Info for OH686_11760 in Pseudomonas sp. S08-1

Annotation: type II secretion system protein J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 28.6 bits, see alignment (E = 8.6e-11) PF07963: N_methyl" amino acids 5 to 28 (24 residues), 30.8 bits, see alignment (E = 1.5e-11) TIGR01711: type II secretion system protein J" amino acids 6 to 205 (200 residues), 223 bits, see alignment E=3e-70 PF11612: T2SSJ" amino acids 58 to 203 (146 residues), 147.5 bits, see alignment E=3.2e-47

Best Hits

KEGG orthology group: K02459, general secretion pathway protein J (inferred from 57% identity to psa:PST_0130)

Predicted SEED Role

"General secretion pathway protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>OH686_11760 type II secretion system protein J (Pseudomonas sp. S08-1)
MSGGQRGFTLLEVVIAISIFALLGLGTYRMLDSVLRTDEATRASEQSLRELTRAFAALDR
DLAQAAVRSVRDPYGDERAALLGELGAIDGSAAIELTRNGWLNPMGLARAQLQRVRWRLS
DKTLERVYWTVLDQAVDSQPRVQTLLTGVRTLEFRYMDERGEWQGQWPPATGERTPEENR
LRLPMAVELKLEHERYGELTRLYRLPEPVVEEKPQAQPETPPPSSEPSPSPSPSPSPSPS
PSPSPAPAPAPVQEVKV