Protein Info for OH686_11635 in Pseudomonas sp. S08-1

Annotation: Acyl-CoA dehydrogenase / probable dibenzothiophene desulfurization enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF02771: Acyl-CoA_dh_N" amino acids 35 to 130 (96 residues), 45.1 bits, see alignment E=2.5e-15 PF02770: Acyl-CoA_dh_M" amino acids 150 to 222 (73 residues), 35.2 bits, see alignment E=2.3e-12 PF08028: Acyl-CoA_dh_2" amino acids 253 to 383 (131 residues), 50.1 bits, see alignment E=6.8e-17 PF00441: Acyl-CoA_dh_1" amino acids 255 to 380 (126 residues), 34.2 bits, see alignment E=5.6e-12

Best Hits

KEGG orthology group: None (inferred from 76% identity to pmy:Pmen_4334)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>OH686_11635 Acyl-CoA dehydrogenase / probable dibenzothiophene desulfurization enzyme (Pseudomonas sp. S08-1)
MASEARHLHPQAEPLLDARLFPVDFGNLTARVERLARKLAESAVERDRRGGHARAERELI
RDSGLLGLAIPQRFDGQERAWPEIYRIVRHLAAADSSLAHLLAFNHLQVATILLHGSAEQ
QRHWLTRAVRERWFWGNASNGRDLGLSLTPREEHFELNGRKSFCSGALGSDALVVSAPRG
NSATERVFLVLPAQREGLAINDDWDAFGQRQTDSGTVQFENVFVDRDELLVSGGQSPRSS
LRVCVSQLILTQLYLGNAQGALDGALRYTREQARPWPGAGVDEAREDPFIQKRYGELWLL
YRGALLLAEQAAERLQQAWDKPALGAAERGEVALLIAEARVASARAALEITSQVFEAMGA
RATAARYGFDRFWRNVRVHSLHDPLDYKVRDIGQWLTSGVAPTPSLYS