Protein Info for OH686_11110 in Pseudomonas sp. S08-1

Annotation: glutamate--cysteine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 193 to 212 (20 residues), see Phobius details TIGR01434: glutamate--cysteine ligase" amino acids 6 to 519 (514 residues), 753.2 bits, see alignment E=6.7e-231 PF04262: Glu_cys_ligase" amino acids 10 to 380 (371 residues), 551.4 bits, see alignment E=3.9e-170

Best Hits

Swiss-Prot: 75% identical to GSH1_AZOVD: Glutamate--cysteine ligase (gshA) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K01919, glutamate--cysteine ligase [EC: 6.3.2.2] (inferred from 75% identity to pfv:Psefu_4038)

Predicted SEED Role

"Glutamate--cysteine ligase (EC 6.3.2.2)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle (EC 6.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>OH686_11110 glutamate--cysteine ligase (Pseudomonas sp. S08-1)
MSDLLSRRLALLGDAAHLSLLTQCLHGIERETLRVTEQGELAQTGHPVALGSALTHPQIT
TDYSEALLEFITPAEPNPADTLADLERIHRFAASQLDGEYLWSPSMPGVLPDEADIPIAR
YGNSNIGRLKYVYRQGLALRYGKTMQCIAGIHYNFSLAEGLWPLLQRLDGDTQSARDYQS
ASYIALIRNFRRYSWLLMYLFGASPALDASFLRGRPHQLQPLDADTLHLPYATSLRMSDL
GYQSSAQSGLTPCYNDLASYTESLRAAVATPYPAYAEIGTKDANGEWLQLNTNIIQIENE
YYSSIRPKRVTYSGERPIQALMSRGVQYVEVRCLDINPYLPMGIDLDQARFLDAFILFCA
LQDSPLLASGVCRASTENFLKTVKEGRRPGLHLQRDGEQVELRTWAGELLDAFAPIAALL
DRAYGGDAYQTALHLQRRKVEDPALTPSARVLAELKDSGESFRAFALRQSKAHAATFRAQ
PLSATEQAQFEAAARQSLAEQAELERAPAGDFDTFVAAYQASILGISV