Protein Info for OH686_10940 in Pseudomonas sp. S08-1

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR00670: aspartate carbamoyltransferase" amino acids 18 to 318 (301 residues), 297.9 bits, see alignment E=3.7e-93 PF02729: OTCace_N" amino acids 18 to 162 (145 residues), 146.4 bits, see alignment E=6.7e-47 PF00185: OTCace" amino acids 170 to 316 (147 residues), 91.2 bits, see alignment E=7.7e-30

Best Hits

Swiss-Prot: 95% identical to PYRB_PSEMY: Aspartate carbamoyltransferase (pyrB) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 95% identity to pfv:Psefu_0314)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>OH686_10940 aspartate carbamoyltransferase (Pseudomonas sp. S08-1)
MPIDAKRSLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKTV
CNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADIFVVR
HADSGAAHFIAEHVCPNLAIINGGDGRHAHPTQGMLDMLTIRRHKGGFENLSVAIVGDIL
HSRVARSNMLALKTLGCPDMRVIAPKTLLPVGIEQYGVTVYSDLAEGLKDVDVVIMLRLQ
RERMQGGLLPSEGEFYRLYGLTEQRLKLAKPDALVMHPGPINRGVEIESAVADGPQSVIL
NQVTYGIAIRMAVLSMAMSGQAAQRQINAEEHN