Protein Info for OH686_10930 in Pseudomonas sp. S08-1

Annotation: Putative pre-16S rRNA nuclease YqgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03652: RuvX
  • amino acids 8 to 139 (132 residues), 147.3 bits, E=1.8e-47
• TIGR00250: putative transcription antitermination factor YqgF
  • amino acids 9 to 138 (130 residues), 146.1 bits, E=3e-47

Best Hits

Swiss-Prot: 87% identical to YQGF_AZOVD: Putative pre-16S rRNA nuclease (Avin_03140) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 90% identity to pmk:MDS_0458)

MetaCyc: 55% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Putative Holliday junction resolvase YggF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Protein Sequence (143 amino acids)

>OH686_10930 Putative pre-16S rRNA nuclease YqgF (Pseudomonas sp. S08-1)
MSGAPRLLLGFDYGTKQIGVAVGQAITGQARELCVLKAQNGVPDWLKVEALIKEWQPDAI
VVGLPLNMDGTKSEMSERAEKFARRLNGRFNLPVHTHDERLTTFEAKGQRLSQGQRGGYR
ERPVDALAAALLLEGWLEQNLSN