Protein Info for OH686_10355 in Pseudomonas sp. S08-1

Annotation: biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 20 to 316 (297 residues), 409 bits, E=5.7e-127
• PF04055: Radical_SAM
  • amino acids 54 to 210 (157 residues), 79.2 bits, E=4.4e-26
• PF06968: BATS
  • amino acids 226 to 316 (91 residues), 104.7 bits, E=2.3e-34

Best Hits

Swiss-Prot: 95% identical to BIOB_PSEU5: Biotin synthase (bioB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 95% identity to psa:PST_3866)

MetaCyc: 73% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (352 amino acids)

>OH686_10355 biotin synthase (Pseudomonas sp. S08-1)
MSASIASVTRHDWSLAEVKALFEQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACP
EDCKYCPQSGHYNTGLDKQKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVL
KMVEGVKALGLETCMTLGKLDQEQTRALAEAGLDYYNHNLDTSPEFYGNIITTRTYAERL
QTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVEGTPLAG
EKDVDPFDFIRMLAVARIMMPKSHVRLSAGREAMNEQMQALAFMAGANSIFYGEKLLTTK
NPQADKDMQLFARLGIKPEEREEHADEVHQAAIEQALVEQRDGQLFYNAASA