Protein Info for OH686_10230 in Pseudomonas sp. S08-1

Annotation: Efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 222 to 262 (41 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 24 to 379 (356 residues), 78.7 bits, see alignment E=7e-26 PF01061: ABC2_membrane" amino acids 185 to 350 (166 residues), 75.7 bits, see alignment E=5.7e-25

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 72% identity to pfv:Psefu_0441)

Predicted SEED Role

"ABC transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>OH686_10230 Efflux ABC transporter, permease protein (Pseudomonas sp. S08-1)
MRLRALARKEFLLMLRDPHALAVLFIMPTLFLVLMAGAMSNYLQDKPPALRVVLQAEPNG
SYEQVFRAALEAQLPGSELLAQGDARSARISLPADFSESLLDDQRQGLALSFPPQLDKLS
RQHLRGAVRIALAQTRLLAFLEDSGDLDANLPLTERLALVQQRTQSQIEEHELLASGDLS
GRANASQLSVPAWLIFGMFFVALPMAGGFQREQQSGALLRFRALDLSLVTLALSKLLPYF
AINLVQFALLLSIGVHGLPLLGLQGLSLPGSPAAYALLAISLSLATCGLGLLLAALARSA
EQALLLGGGINIILASLGGIMVPKSVMPAAMGQLAEVSPMSWALDAFLTLLVGQGSLADI
APYCFRLLLMAALLGGGGWLLFRRRVQQTQWTND