Protein Info for OH686_10025 in Pseudomonas sp. S08-1

Annotation: Type IV pilus biogenesis protein PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF11741: AMIN" amino acids 157 to 251 (95 residues), 62.5 bits, see alignment E=8.9e-21 TIGR02515: type IV pilus secretin PilQ" amino acids 273 to 700 (428 residues), 535.9 bits, see alignment E=3.9e-165 PF07660: STN" amino acids 299 to 346 (48 residues), 36.8 bits, see alignment 6.9e-13 PF03958: Secretin_N" amino acids 372 to 439 (68 residues), 57.6 bits, see alignment E=2.9e-19 PF00263: Secretin" amino acids 543 to 699 (157 residues), 174.3 bits, see alignment E=4.2e-55

Best Hits

Swiss-Prot: 76% identical to PILQ_PSEAE: Fimbrial assembly protein PilQ (pilQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 77% identity to pag:PLES_54301)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (708 amino acids)

>OH686_10025 Type IV pilus biogenesis protein PilQ (Pseudomonas sp. S08-1)
MNISFTRLGASLLLALVAPTLMAAELQGLDVAALPGDKIELKLSFDQAMSAPRGYTIEQP
ARIALDLPGVINKLGTKNRELGVGNARSVTVVEAKDRTRLIINLTTLVPYSTRAEGKDLY
VVVGDAAGRSLSSTPAATVAEVAKPAKPALAGRAINGIDFQRGEQGEGNVVIELSDSSVS
ADIQEQGGKIRLEFSKAQLPEHLRARLDVKDFATPVQFVNASAQADKVTISIEPTGFYDY
LAFQTDNKLTVSFKPLSRDDVEKRKAERFAYSGEKLSLNFQDIDVRSVLQLIADFTDLNL
VASDTVQGNITLRLQNVPWDQALDLVLKTRGLDKRKVGNVLLIAPADEIAARERQELEAQ
NQIAELAPLRRELIQVNYAKAADIAALFQSVAATEGGGAGERGTVTVDDRTNSIIAYQTQ
DRLDELRRIVAQLDIPVRQVMIEARIVEASVGYEKDIGVRWGGTLGGAGSKWRSYGKDGA
TGIEDQDGANCGPFAGVCTRPTVENGDSNVPVPFVDMGASEATSGIGIGFITDNAILDLQ
LSAMEASGNGEIISQPKVVTSDKETAKILKGSEIPYQEASSSGATSVSFKEAALSLEVTP
QITPDNRIIMEVKVNKDAPDYDREVNGVPPINKNEVNAKILVEDGETIVIGGVFSNTQSK
SVEKVPLLGDIPFIGRVFRRDAVRDEKNELLVFITPRIMNSQAIAVSK