Protein Info for OH686_08455 in Pseudomonas sp. S08-1

Annotation: GTP cyclohydrolase 1 type 2-related YbgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00486: dinuclear metal center protein, YbgI/SA1388 family" amino acids 5 to 250 (246 residues), 212.5 bits, see alignment E=4e-67 PF01784: DUF34_NIF3" amino acids 12 to 240 (229 residues), 202 bits, see alignment E=6.1e-64

Best Hits

Swiss-Prot: 81% identical to GCH1L_PSEAE: GTP cyclohydrolase 1 type 2 homolog (PA4445) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 87% identity to ppg:PputGB1_4547)

Predicted SEED Role

"FIG137478: Hypothetical protein YbgI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>OH686_08455 GTP cyclohydrolase 1 type 2-related YbgI (Pseudomonas sp. S08-1)
MAIALTTLVEEADRFLGAARISDYCPNGLQVEGRPQVRRIVSGVTASQALLDAAVEAEAD
VVLVHHGYFWKGEDACITGIKRRRLQTLLGNDISLLAYHLPLDVHAEVGNNVQLARQLDI
TVEGPLDPNNPKVVGLLGSLAEPMSARDFARRVQEVLGREPLLVEGQGMVRRIGWCTGGG
QGYIDNAIAAGVDLYLTGEASEQTFHSARENGVGFIAAGHHATERYGVQALGDYLARRFA
IEHLFIDCPNPV