Protein Info for OH686_07090 in Pseudomonas sp. S08-1

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00106: adh_short" amino acids 5 to 186 (182 residues), 152.5 bits, see alignment E=2.6e-48 PF01370: Epimerase" amino acids 6 to 72 (67 residues), 22.1 bits, see alignment E=2.3e-08 PF08659: KR" amino acids 6 to 158 (153 residues), 32.9 bits, see alignment E=1.5e-11 PF13561: adh_short_C2" amino acids 12 to 199 (188 residues), 118.2 bits, see alignment E=1.1e-37 PF08643: DUF1776" amino acids 78 to 262 (185 residues), 30.7 bits, see alignment E=5.6e-11

Best Hits

KEGG orthology group: None (inferred from 72% identity to pmk:MDS_1069)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>OH686_07090 Oxidoreductase, short-chain dehydrogenase/reductase family (Pseudomonas sp. S08-1)
MTQPVVLITGCSSGIGRALADAFKAADYQVWACARKPQDLAGLTAAGFVAVALDVNDAVA
VQRAVERVQSEAGRLDVLINNAGYGAMGPLLDGGAEGMRQQFETNVFSLVELTRACFPLL
RASRGLVINIGSISSVLITPFAGAYCASKAAVHAISGALRLELAPFGIQVMEVQPGAIQS
SFGSNASHSAEQLVNEQSPWWPVREGIRARANASQEKPTPAAEFAATLLAAVRQTERPAL
LRIGNGSCSLPLINRLLPRKLMDRMLSRRFGLDTQL