Protein Info for OH686_06970 in Pseudomonas sp. S08-1

Annotation: GlpG protein (membrane protein of glp regulon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 77 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details PF01694: Rhomboid" amino acids 47 to 179 (133 residues), 69.6 bits, see alignment E=1.5e-23

Best Hits

KEGG orthology group: None (inferred from 65% identity to pmk:MDS_3707)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>OH686_06970 GlpG protein (membrane protein of glp regulon) (Pseudomonas sp. S08-1)
MTAWLAPRLRLLAGIAALMLALQVGNSLSGNALTVWGVLPRHVDSLPGILFAPWLHAGWW
HLLNNLPGLILLGWLALLGSLRQFLAASAFIIIGSGLLVWLFARPGMHLGASGWVFGLWG
LLLARAWFERSLGSLLIALLVLFYYGGWWLGLLPSQGVSFEYHLFGALCGVLFAALSRHR
RST