Protein Info for OH686_06375 in Pseudomonas sp. S08-1

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase" amino acids 10 to 229 (220 residues), 240.6 bits, see alignment E=6.6e-76 PF01128: IspD" amino acids 11 to 226 (216 residues), 221.5 bits, see alignment E=1.2e-69 PF12804: NTP_transf_3" amino acids 11 to 136 (126 residues), 32.5 bits, see alignment E=9.3e-12

Best Hits

Swiss-Prot: 78% identical to ISPD_PSEFS: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 78% identity to pfs:PFLU1293)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>OH686_06375 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase  (Pseudomonas sp. S08-1)
MNNPELPAFWVVIPAAGIGSRMRADRPKQYLQLAGRTILEHSLNCFLDHPRLKGLVLSLA
ADDPFWPTLACANDPRICRAAGGAERADSVLAGLLQLLELGAEAEDWVLVHDAARPNLAR
SDLDQLLGELASDPVGGLLAVPARDTLKRAGADGRVAETVDRSLIWQAYTPQMFRFAALH
RALADALVAGVAITDEASALEWAGQAPKLVEGRADNLKITRPEDLEWLRQRWVHKA