Protein Info for OH686_06230 in Pseudomonas sp. S08-1

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF13439: Glyco_transf_4" amino acids 19 to 182 (164 residues), 106.1 bits, see alignment E=6.2e-34 PF13579: Glyco_trans_4_4" amino acids 20 to 173 (154 residues), 69.2 bits, see alignment E=1.6e-22 PF13477: Glyco_trans_4_2" amino acids 28 to 122 (95 residues), 26.2 bits, see alignment E=2.5e-09 PF00534: Glycos_transf_1" amino acids 194 to 356 (163 residues), 100.9 bits, see alignment E=1.9e-32 PF13692: Glyco_trans_1_4" amino acids 207 to 343 (137 residues), 100.7 bits, see alignment E=2.5e-32

Best Hits

KEGG orthology group: None (inferred from 77% identity to avn:Avin_10200)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>OH686_06230 Glycosyltransferase (Pseudomonas sp. S08-1)
MNVTSLHIALVSETYPPEVNGVANTLGRLCQGLRERGHRLQLVRPRQADEPNRSDEELLL
TRGWPLPGYAGLQWGHASLHKLLRRWKRNRPDVLYIATEGPLGLSALRAARRLGIPVVSG
FHTNFQQYSDLYGFGLLTRLLTGYLRWFHNRSRLTLVPSPSQRLELQRRGFERLELLARG
VDGQLFHPARRSSELRAEWGMAEDEIAVVHVGRLAAEKNLQLLVRAFRALQRGLPQRRLR
LVLVGDGPLRAPLQEQLPDALFCGVQRGEALAAHYASGDLFLFPSLSETFGNVVLEALAS
GLAVVAFDQAAAAQHIRHGHNGALAIPGDEQAFIEAARWLLEDGEIFRRVRLNARQHAGK
QGWPAIVEQFEEHLLQARQA