Protein Info for OH686_05955 in Pseudomonas sp. S08-1

Annotation: (R)-3-hydroxydecanoyl-ACP:CoA transacylase PhaG (3-hydroxyacyl-CoA-acyl carrier protein transferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 27 to 256 (230 residues), 30 bits, E=5e-11
• PF00561: Abhydrolase_1
  • amino acids 29 to 127 (99 residues), 32.4 bits, E=1.2e-11
• PF12697: Abhydrolase_6
  • amino acids 30 to 257 (228 residues), 37 bits, E=8.8e-13

Best Hits

Swiss-Prot: 60% identical to PHAG_PSEAE: (R)-3-hydroxydecanoyl-ACP:CoA transacylase (phaG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 59% identity to pfs:PFLU1434)

MetaCyc: 58% identical to 3-hydroxyacyl-CoA-acyl carrier protein transferase (Pseudomonas putida KT2440)
2.4.1.-

Predicted SEED Role

"(R)-3-hydroxydecanoyl-ACP:CoA transacylase PhaG (3-hydroxyacyl-CoA-acyl carrier protein transferase) (EC 2.4.1.-)" in subsystem Rhamnolipids in Pseudomonas (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (292 amino acids)

>OH686_05955 (R)-3-hydroxydecanoyl-ACP:CoA transacylase PhaG (3-hydroxyacyl-CoA-acyl carrier protein transferase)  (Pseudomonas sp. S08-1)
MKAETAVLDIQGQYRVYTEFYRADGAEQTIILVNGSLSTTASFAQTVRYLHPHFNVVLFD
LPYAGHSREYNSHDQFLTREDEADILLALVEHFACDTVLSFSWGGIATLQALARKPPRIE
RAVINSFSPVVNSAMLGYLRAGLAVMRDCDRESIGMVLNGTIGKHLPSLFKRYNHRHVTG
LERYEYEQMSFHVETVLNNGGRSCVSFAGQIDIPLLFVNGEWDEYTTPEDARLFTQYVRH
GEFRTIPQAGHFLDMEHKAAWMQTRDALLAFLLPPTTSRARSQTAEKHALAV