Protein Info for OH686_05930 in Pseudomonas sp. S08-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 73 to 94 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 164 to 191 (28 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details PF09925: DUF2157" amino acids 44 to 180 (137 residues), 56.4 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: None (inferred from 55% identity to pae:PA0736)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>OH686_05930 hypothetical protein (Pseudomonas sp. S08-1)
MPLTRDQAQQRADDIQAFRRETQRLRAEDALALGDEPLARIASHHDQLLAQYRSSFDIDH
DQQTKRLSLSMRVVSLLGALALAASLLFFFYQFWGLFGEALQVGILVGFSLGSLLLTFVL
QQRDASGYFAKLSAVLALACFMLNIHMLGQIFNITPTDKALLPWAAYALLLAYTCNARLL
LAAGLACLLAYSGMRISEWCGWLWLEAAERPEHFLPGGLLVFVLPALLSQARFSGFAATY
RIVGMLALLLPMLVLANWGRGSYLPFEYAGIEKVYQLLGFAASALFIWLGIRRDWAEVTL
LGQLSFLLFLFIKMVDWWWDVLPKYLFFLILGLTAILALLVLGRLRRGHKGGERA