Protein Info for OH686_05895 in Pseudomonas sp. S08-1

Annotation: Urea carboxylase-related ABC transporter, substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03427: ABC transporter periplasmic binding protein, urea carboxylase region" amino acids 26 to 352 (327 residues), 427.5 bits, see alignment E=1.7e-132 PF12974: Phosphonate-bd" amino acids 48 to 201 (154 residues), 30.9 bits, see alignment E=3e-11 PF09084: NMT1" amino acids 56 to 241 (186 residues), 50 bits, see alignment E=5.7e-17

Best Hits

KEGG orthology group: None (inferred from 68% identity to pmy:Pmen_1366)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, periplasmic substrate-binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>OH686_05895 Urea carboxylase-related ABC transporter, substrate-binding protein (Pseudomonas sp. S08-1)
MLTRLLSCSLLVLLLLQPAHAAPEKRPFKVCWSIYAGWMLWGYMAEQGIIDKWADKYGIE
IQVQQVPDYVASIEQYTANQFDACAMTNMDALTIPAAAGLDSTALIVGDFSAGADGILLR
GGSKDLKDLKGKTILLVENSVSHYLLSRALEWAHLQPSDVTIENVSDTELAQAWRSGRGD
AVVTWNPILSDLRQDGDSVQVFSSRHVPGEILDLLVINSQTLAQHPELGRALTGAWFEGM
RLMGLPTPAGAAARAQMAGAADATPADFDEQLKTIRSFYAPRSAAAFARGEKMPDMMQRV
ANFADAQQLLGEGKGLQRLGISFGDDRVLGNKAQIMLRFNPTYMQLAADNQL