Protein Info for OH686_05870 in Pseudomonas sp. S08-1

Annotation: Branched-chain acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF02771: Acyl-CoA_dh_N" amino acids 7 to 116 (110 residues), 112.8 bits, see alignment E=2.3e-36 PF02770: Acyl-CoA_dh_M" amino acids 122 to 215 (94 residues), 92.7 bits, see alignment E=2.6e-30 PF00441: Acyl-CoA_dh_1" amino acids 227 to 377 (151 residues), 174.7 bits, see alignment E=3e-55 PF08028: Acyl-CoA_dh_2" amino acids 244 to 365 (122 residues), 77 bits, see alignment E=3.4e-25

Best Hits

Swiss-Prot: 54% identical to ACAD8_MOUSE: Isobutyryl-CoA dehydrogenase, mitochondrial (Acad8) from Mus musculus

KEGG orthology group: None (inferred from 91% identity to pmk:MDS_1431)

MetaCyc: 44% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.3.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.1

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>OH686_05870 Branched-chain acyl-CoA dehydrogenase  (Pseudomonas sp. S08-1)
MDFELDDEQRLLVDSARAFAAKELAPHAADWDREHHFPVEVIRRAAEQGYLALYLKEEDG
GLGLSRLTSSLIFEQLAAGCVATTAYITIHNMATWMLASFADQALKDAWLPGLAEGRLLA
SYCLTEPDAGSDAAHLRSRARRDGDDYVLDGSKCFISGAGSTDVLIVMARTGEDGAKGIS
CFLVPANAEGVKYGRNEDKMGWKAQPTRTITFEGVRIPAGNRIGPEGQGFVYAMKGLDGG
RLNIASCSLGAAQAALEQSLRYVEERKQFGKALAEFQALQFKLADMLTDLTASRQMVRLA
AHKLDHGHAEAALYCAMAKRFATDHCFTLCNDALQLHGGYGYLNDYPLERWVRDSRVHQI
LEGTNEIMRVIIARRLLDQGGMLDRLL