Protein Info for OH686_05535 in Pseudomonas sp. S08-1

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 199 (184 residues), 118.8 bits, see alignment E=1.1e-38

Best Hits

KEGG orthology group: None (inferred from 70% identity to axy:AXYL_05416)

Predicted SEED Role

"transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>OH686_05535 Transporter, LysE family (Pseudomonas sp. S08-1)
MALHTWLIYLTAVFGLSLTPGPNGLLALTHGALYGHRRALWTVTGGMLGFVLLMALSMFG
LAALLKASVHALLVLKWLGAAYLIWLGIQLWRAPPLHLTPLQSAAPRPGLQLFRQGLLSA
LSNPKVILFFGAFLPQFLDPARSLWLQFAVMAATFAIVEGIVEYLLARTAQRTRPWLERA
GRGFNRCCGGLFAAMGLALPLTR