Protein Info for OH686_05375 in Pseudomonas sp. S08-1

Annotation: tRNA (mo5U34)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF08003: Methyltransf_9" amino acids 12 to 322 (311 residues), 462.9 bits, see alignment E=1.4e-142 TIGR00452: tRNA (mo5U34)-methyltransferase" amino acids 13 to 321 (309 residues), 459.5 bits, see alignment E=2.1e-142 PF13489: Methyltransf_23" amino acids 115 to 270 (156 residues), 50.5 bits, see alignment E=6.2e-17 PF13649: Methyltransf_25" amino acids 126 to 220 (95 residues), 31.4 bits, see alignment E=7.4e-11 PF08242: Methyltransf_12" amino acids 127 to 221 (95 residues), 30.1 bits, see alignment E=2e-10 PF08241: Methyltransf_11" amino acids 127 to 224 (98 residues), 33.1 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 84% identical to CMOB_PSEMY: tRNA U34 carboxymethyltransferase (cmoB) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 84% identity to pmy:Pmen_1481)

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>OH686_05375 tRNA (mo5U34)-methyltransferase (Pseudomonas sp. S08-1)
MIFSRLDLDALQQQLAGSPLQEWAADLPAQLDAKLAVGHGDLARWFAAVESLPALTVGTA
ELRNALRLDGACDETTRTALKTALQGLIPWRKGPFELFGVHIDTEWRSDWKWQRVAPHLD
LAGKRILDVGCGNGYYMWRMLGAGADAVIGVDPNWLFLNQFLAVKNYLPDAPAWHLPLAL
EELPAKLEGFDTVFSMGVLYHRRSPIDHLLELKDCLLKGGELVLETLVVEGDAQQVLVPE
DRYAMMRNVWFLPSVPALELWLRRAGFVDVRCVDVSTTSVEEQRSTDWMRYQSLPEFLDP
ADHSRTLEGLPAPTRAVLLARKP